MilliporeSigma
All Photos(2)

AV32718

Sigma-Aldrich

Anti-NFKB2 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

101 kDa

species reactivity

bovine, guinea pig, mouse, rabbit, horse, dog, rat, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... NFKB2(4791)

General description

NFKB2 forms a part of the nuclear factor-κB transcriptional complex that regulates inflammatory and immunological activities. NKB2 is known to sequester NF-κB-related proteins in human breast cancer cells. This transcriptional component has also been implicated in lymphoid malignancies.
Rabbit Anti-NFKB2 (AB2) antibody recognizes human, canine, mouse, rat, chicken and bovine NFKB2.

Immunogen

Synthetic peptide directed towards the N terminal region of human NFKB2

Application

Rabbit Anti-NFKB2 (AB2) antibody can be used for western blot (1.0μg/ml) and IHC (4-8μg/ml) applications.

Biochem/physiol Actions

NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.

Sequence

Synthetic peptide located within the following region: LPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service