MilliporeSigma
All Photos(2)

AV35122

Sigma-Aldrich

Anti-VDAC1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-Voltage-dependent anion channel 1

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

31 kDa

species reactivity

zebrafish, mouse, sheep, bovine, guinea pig, pig, horse, human, rat, rabbit, canine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... VDAC1(7416)

General description

VDAC facilitates the exchange of ions and molecules between mitochondria and cytosol and is regulated by the interactions with other proteins and small molecules.

Immunogen

The immunogen for anti-VDAC1 antibody: synthetic peptide derected towards the C terminal of human VDAC1

Application

Muscle whole-cell extracts from mice were subjected to western blot analysis using rabbit anti-vdac as the primary antibody at a 1:2000 dilution.

Sequence

Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service