MilliporeSigma
All Photos(1)

AV35258

Sigma-Aldrich

Anti-P2RX2 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-Purinergic receptor P2X, ligand-gated ion channel, 2
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

52 kDa

species reactivity

human, mouse, rat, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... P2RX2(22953)

General description

P2RX2 (P2X2) is a purinoceptor that functions as an ATP-gated ion channel. The ectodomain movements of this receptor have been analyzed using disulphide locking. In propyl-methanethiosulfonate-attached P2X2 receptors, lipid intercalation can be facilitated between the transmembrane domains during channel opening.
Rabbit Anti-P2RX2 antibody recognizes human, mouse, rat, and bovine P2RX2.

Immunogen

Synthetic peptide directed towards the N terminal region of human P2RX2

Application

Rabbit Anti-P2RX2 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Biochem/physiol Actions

The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle.

Sequence

Synthetic peptide located within the following region: YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service