MilliporeSigma
All Photos(4)

Documents

AV40568

Sigma-Aldrich

Anti-PCBP2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-Poly(rC) binding protein 2
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

40 kDa

species reactivity

mouse, horse, bovine, rat, guinea pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PCBP2(5094)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB1404172AV40943AV40630
Quality Level

100

Quality Level

-

Quality Level

100

Quality Level

100

antibody form

IgG fraction of antiserum

antibody form

purified immunoglobulin

antibody form

IgG fraction of antiserum

antibody form

IgG fraction of antiserum

biological source

rabbit

biological source

mouse

biological source

rabbit

biological source

rabbit

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

UniProt accession no.

Q6IPF4

UniProt accession no.

Q15366

UniProt accession no.

Q9HCU2

UniProt accession no.

Q15365

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Poly(rC) binding protein 2 (PCBP2) is a poly(rC)-binding protein that regulate of RNA processing. PCBP2 is believed to be involved in the shuttling of nascent mRNPs to processing bodies (P-bodies) which are involved in mRNA degradation and siRNA- or miRNA-mediated gene silencing. PCBP2 promotes the processing of various microRNAs (miRNA) via its association with Dicer. MicroRNA processing may be regulated by cytosolic iron via the PCBP2:Dicer-dependent processes. The PCBP2-AIP4 axis defines a signaling cascade for MAVS degradation and ′fine tuning′ of antiviral innate immunity. PCBP2 stabilization of mRNA increases the expression of STAT1 and STAT2 which enhances the antiviral effect of IFN-α.

Specificity

Anti-PCBP2 (AB1) polyclonal antibody reacts with poly(rC) binding protein 2 proteins.

Immunogen

Synthetic peptide directed towards the middle region of human PCBP2

Application

Anti-PCBP2 (AB1) polyclonal antibody is used to tag poly(rC) binding protein 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of poly(rC) binding protein 2 in RNA trafficking and processing.

Biochem/physiol Actions

PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5′-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5′-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.

Sequence

Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service