AV40572

Anti-SFPQ antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 78 kDa
• species reactivity: dog, human, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_005057
• UniProt accession no.: P23246
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SFPQ(6421)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human SFPQ

Biochem/physiol Actions

SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5′-CTGAGTC-3′ in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.

Sequence

Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable