AV44535

Sigma-Aldrich

Anti-SDCBP antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-ST1, Anti-MDA-9, Anti-TACIP18, Anti-Syndecan binding protein (syntenin), Anti-SYCL
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

rat, guinea pig, bovine, human, dog, rabbit, mouse, horse

concentration

0.5 mg - 1 mg/mL

application(s)

immunohistochemistry: suitable
western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SDCBP(6386)

Immunogen

Synthetic peptide directed towards the middle region of human SDCBP

Application

Anti-SDCBP antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Syndecan binding protein (SDCBP; syntenin, mda-9) is a scaffolding protein containing a PDZ domain that has functions that include cell adhesion, proliferation, protein trafficking, cytoskeletal organization and activation of transcription factors. It promotes metastasis of cancer cells by activating FAK, NF-κB, c-Src and p38-MAPK pathways.

Sequence

Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Habib Boukerche et al.
Cancer research, 67(4), 1812-1822 (2007-02-20)
mda-9/Syntenin is a scaffolding PDZ domain-containing protein overexpressed in multiple human cancers that functions as a positive regulator of melanoma metastasis. Using a normal immortal human melanocyte cell line and weakly and highly metastatic human melanoma cell lines, we presently...
Habib Boukerche et al.
Proceedings of the National Academy of Sciences of the United States of America, 105(41), 15914-15919 (2008-10-04)
The scaffold PDZ-domain containing protein mda-9/syntenin functions as a positive regulator of cancer cell progression in human melanoma and other tumors. mda-9/Syntenin regulates cell motility and invasion by altering defined biochemical and signaling pathways, including focal adhesion kinase (FAK), p38...
Devanand Sarkar et al.
Cancer research, 68(9), 3087-3093 (2008-05-03)
Cancer is a progressive disease that, in many instances, if untreated, can culminate in metastatic spread of primary tumor cells to distant sites in the body. Metastasis frequently confers virulence and therapy resistance to cancer cells, and defining the molecular...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.