AV48225

Sigma-Aldrich

Anti-VIM (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-FLJ36605, Anti-Vimentin
Pricing and availability is not currently available.

biological source

rabbit

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

54 kDa

species reactivity

human, mouse, rat, bovine, rabbit, guinea pig, sheep, horse

concentration

0.5 mg - 1 mg/mL

application(s)

western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... VIM(7431)

General description

Vimentin is a type III intermediary filament protein that is present in mesenchymal tissues. Vimentins regulate several cellular functions such as response to mechanical stress, cell shape, and cell movement. These proteins may also be involved in the pathogenesis of tissue fibrosis . Anti-VIM (AB1) antibody is specific for VIM in humans, bovines, rats, mice and chickens.

Immunogen

The immunogen for anti-VIM antibody: synthetic peptide derected towards the N terminal of human VIM

Application

Anti-VIM (AB1) antibody is suitable for use in western blot.

Sequence

Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Toshifumi Murai et al.
Journal of surgical oncology, 109(7), 684-689 (2014-01-24)
Epithelial-to-mesenchymal transition (EMT) is considered to play an important role in cancer invasion and metastasis. The mRNA levels of an epithelial marker (E-cadherin), mesenchymal marker (vimentin), and Zeb-1 were measured in 11 gastric cancer cell lines. Functional analysis was performed...
Azariyas A Challa et al.
Molecular and cellular biology, 31(18), 3773-3789 (2011-07-13)
The stem-loop in the 5' untranslated region (UTR) of collagen α1(I) and α2(I) mRNAs (5'SL) is the key element regulating their stability and translation. Stabilization of collagen mRNAs is the predominant mechanism for high collagen expression in fibrosis. LARP6 binds...
Jun Won Park et al.
Molecular cancer research : MCR, 12(8), 1088-1099 (2014-05-03)
Loss of E-cadherin (CDH1), Smad4, and p53 has been shown to play an integral role in gastric, intestinal, and breast cancer formation. Compound conditional knockout mice for Smad4, p53, and E-cadherin were generated to define and compare the roles of...
Janet M C Ngu et al.
Cardiovascular pathology : the official journal of the Society for Cardiovascular Pathology, 23(6), 335-343 (2014-07-26)
Tissue inhibitor of metalloproteinase-2 (TIMP-2) is an endogenous inhibitor of matrix metalloproteinases (MMPs) that attenuates maladaptive cardiac remodeling in ischemic heart failure. We examined the effects of TIMP-2 on human cardiac fibroblast activation and extracellular matrix (ECM) remodeling. Human cardiac...
Alexandra von Baer et al.
Pathology, research and practice, 210(10), 698-703 (2014-07-01)
Extraskeletal osteosarcoma is a rare neoplasia within the broad differential diagnostic spectrum of calcifying intramuscular lesions. We present a case of a slowly increasing mass within the left vastus lateralis muscle. At first presentation the patient showed a partially calcified...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.