AV49223
Anti-MAP3K2 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
All Photos(1)
Synonym(s):
Anti-MEKK2, Anti-MEKK2B, Anti-Mitogen-activated protein kinase kinase kinase 2
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
70 kDa
species reactivity
pig, dog, human, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MAP3K2(10746)
Immunogen
Synthetic peptide directed towards the N terminal region of human MAP3K2
Application
Anti-MAP3K2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
MAP Kinase Kinase Kinase 2 (MAP3K2; MEKK2) belongs to a family of enzymes that activates their substrate by dual phosphorylation at serine and threonine residues. MAP3K2 activates the kinases involved in the MAPK signaling pathway. It activates Iκ B kinases that are important regulators of NF-κB pathway. This kinase also facilitates cross-talk between c- Jun and FAK and MAPK and activates several downstream targets that contribute to cell proliferation, inflammation apoptosis and motility.
Sequence
Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Ahmed A Mirza et al.
Biochimica et biophysica acta, 1843(5), 945-954 (2014-02-05)
MEK Kinase 2 (MEKK2) is a serine/threonine kinase that functions as a MAPK kinase kinase (MAP3K) to regulate activation of Mitogen-activated Protein Kinases (MAPKs). We recently have demonstrated that ablation of MEKK2 expression in invasive breast tumor cells dramatically inhibits
M R Cronan et al.
Oncogene, 31(34), 3889-3900 (2011-12-06)
Analysis of patient tumors suggests that multiple MAP3 kinases (MAP3Ks) are critical for growth and metastasis of cancer cells. MAP3Ks selectively control the activation of extracellular signal-regulated kinase 1/2 (ERK1/2), Jun N-terminal kinase (JNK), p38 and ERK5 in response to
Deepa R Hammaker et al.
Journal of immunology (Baltimore, Md. : 1950), 172(3), 1612-1618 (2004-01-22)
The mitogen-activated protein kinase (MAPK) c-Jun N-terminal kinase (JNK) is a critical regulator of collagenase-1 production in rheumatoid arthritis (RA). The MAPKs are regulated by upstream kinases, including MAPK kinases (MAPKKs) and MAPK kinase kinases (MAP3Ks). The present study was
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service