MilliporeSigma
All Photos(3)

AV51356

Sigma-Aldrich

Anti-ASPH antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-Aspartate β-hydroxylase, Anti-BAH, Anti-CASQ2BP1, Anti-HAAH, Anti-JCTN, Anti-Junctin

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

25 kDa

species reactivity

canine, mouse, rat, bovine, horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... ASPH(444)

Immunogen

The immunogen for anti-ASPH antibody: synthetic peptide derected towards the N terminal of human ASPH

Application

Anti-ASPH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

Aspartate beta-hydroxylase (ASPH; Junctin) is a Ca+2-cycling protein that regulates the amount of Ca+2 in stored and released by the sarcoplasmic reticulum. In collaboration with another protein called Triadin, ASPH controls the contractile properties of heart during the excitation-contraction coupling.

Sequence

Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service