AV54283

Sigma-Aldrich

Anti-APOE antibody produced in rabbit

affinity isolated antibody

Synonym(s):
Anti-MGC1571, Anti-Apoprotein, Anti-Apolipoprotein E, Anti-AD2
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

application(s)

immunohistochemistry: suitable
western blot: suitable

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... APOE(348)

General description

APOE gene encodes for Apolipoprotein E, a main apoprotein of the chylomicron. ApoE is a 299 amino acid containing plasma protein with a molecular weight of 34kDa. It is synthesized primarily in liver and is mapped on to chromosome 19 in a cluster with APOC1 and APOC2.

Immunogen

Synthetic peptide directed towards the N terminal region of human APOE

Application

Anti-APOE antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

ApoE binds to its specific receptor and mediates the transport of lipid and cholesterol, ligands for the low-density lipoprotein (LDL) and very low density lipoprotein (VLDL) receptors, through the bloodstream. It is also involved in repair mechanism against tissue injury. For example, increased amounts of apolipoprotein E are present at peripheral nerve injury and regeneration site. Mutation in APOE gene leads to familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides results in impaired clearance of chylomicron and VLDL remnant.

Sequence

Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
R W Mahley
Science (New York, N.Y.), 240(4852), 622-630 (1988-04-29)
Apolipoprotein E is a plasma protein that serves as a ligand for low density lipoprotein receptors and, through its interaction with these receptors, participates in the transport of cholesterol and other lipids among various cells of the body. A mutant...
María Solanas-Barca et al.
Atherosclerosis, 222(2), 449-455 (2012-04-07)
Rare mutations in the APOE gene, undetectable with the usual genotyping technique, are responsible for dominant familial dysbetalipoproteinemia (FD) and therefore could be easily misclassified as familial combined hyperlipidemia (FCHL). We aimed to identify APOE mutations associated with dominant combined...
W A Groenewegen et al.
Arteriosclerosis and thrombosis : a journal of vascular biology, 14(11), 1695-1704 (1994-11-01)
We identified the first insertion mutation that specifies an apolipoprotein (apo)B truncation, apoB-70.5, in a father and son with hypobetalipoproteinemia (total and low-density lipoprotein [LDL] cholesterol < 5th percentile, plasma apoB levels approximately one third of normal). The mutation is...
Y K Paik et al.
Proceedings of the National Academy of Sciences of the United States of America, 82(10), 3445-3449 (1985-05-01)
The gene for human apolipoprotein E (apo-E) was selected from a library of cloned genomic DNA by screening with a specific cDNA hybridization probe, and its structure was characterized. The complete nucleotide sequence of the gene as well as 856...
Barbara Castella et al.
Nature communications, 8, 15663-15663 (2017-06-06)
Vγ9Vδ2 T cells are activated by phosphoantigens, such as isopentenyl pyrophosphate (IPP), which is generated in the mevalonate pathway of antigen-presenting cells. IPP is released in the extracellular microenvironment via unknown mechanisms. Here we show that the ATP-binding cassette transporter...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.