MilliporeSigma
All Photos(1)

Documents

C4874

Sigma-Aldrich

Calmodulin bovine

recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE)

Sign Into View Organizational & Contract Pricing

Synonym(s):
CaM, Phosphodiesterase 3:5-cyclic nucleotide activator, Phosphodiesterase 3′:5′-cyclic nucleotide activator
MDL number:
NACRES:
NA.26

biological source

bovine

Quality Level

recombinant

expressed in E. coli

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

mol wt

Mw 19000.9 by amino acid sequence

composition

Protein, ≥85%

UniProt accession no.

storage temp.

−20°C

Gene Information

bovine ... CALM(100297344)

Related Categories

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
P1431P0270ZRB1133
Calmodulin bovine recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE)

Sigma-Aldrich

C4874

Calmodulin bovine

recombinant

expressed in E. coli

recombinant

-

recombinant

-

recombinant

expressed in HEK 293 cells

assay

≥98% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

assay

-

assay

-

form

lyophilized powder

form

lyophilized powder

form

lyophilized powder

form

lyophilized

mol wt

Mw 19000.9 by amino acid sequence

mol wt

16.79 kDa

mol wt

-

mol wt

calculated mol wt 47.58 kDa, observed mol wt ~45 kDa

UniProt accession no.

P62157

UniProt accession no.

P62157

UniProt accession no.

P62157

UniProt accession no.

P09543

General description

Calmodulin from bovine takes up a dumb-bell-structure. Two calcium binding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.

Application

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.

Biochem/physiol Actions

Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.
Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.

Physical properties

Sequence:
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Preparation Note

Produced using animal component-free materials.

Storage Class Code

11 - Combustible Solids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Customers Also Viewed

Chihiro Nakajima et al.
The Analyst, 136(1), 113-119 (2010-10-12)
A method for de novo sequencing of N(α)-blocked proteins by mass spectrometry (MS) is presented. The approach consists of enzymatic digestion of N(α)-blocked protein, recovery of N-terminal peptide by depletion of non-N-terminal peptides from the digest pool, and selective derivatization
Positive cooperative binding of calcium to bovine brain calmodulin
Crouch, Thomas H and Klee, Claude B
Biochemistry, 19(16), 3692-3698 (1980)
Erika Kovacs et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 24(10), 3829-3839 (2010-06-05)
Lipid-protein interactions are rarely characterized at a structural molecular level due to technical difficulties; however, the biological significance of understanding the mechanism of these interactions is outstanding. In this report, we provide mechanistic insight into the inhibitory complex formation of
Mildly acidic conditions eliminate deamidation artifact during proteolysis: digestion with endoprotease Glu-C at pH 4.5
Liu S, et al.
Amino Acids, 48(4), 1059-1067 (2016)
Structure and mechanism of calmodulin binding to a signaling sphingolipid reveal new aspects of lipid-protein interactions
Kovacs E, et al.
Faseb Journal, 24(10), 3829-3839 (2010)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service