Skip to Content
MilliporeSigma

HPA001274

Sigma-Aldrich

Anti-RPS6KA5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-90 kDa ribosomal protein S6 kinase 5 antibody produced in rabbit, Anti-Nuclear mitogen- and stress-activated protein kinase 1 antibody produced in rabbit, Anti-RSK-like protein kinase antibody produced in rabbit, Anti-RSKL antibody produced in rabbit, Anti-Ribosomal protein S6 kinase α-5 antibody produced in rabbit

Slide 1 of 5

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$571.00

$571.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

Skip To


Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RPS6KA5(9252)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
HPA003904SAB4300084SAB4300202
biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

-

species reactivity

human

species reactivity

human

species reactivity

mouse, rat, human

species reactivity

human, rat, mouse

General description

RPS6KA5 (Ribosomal protein S6 kinase a-5) encodes a serine/threonine-protein kinase consisting of two protein kinase domains in a single polypeptide. It is also called as mitogen and stress-activated protein kinase-1 (MSK-1).

Immunogen

Ribosomal protein S6 kinase α-5 recombinant protein epitope signature tag (PrEST)

Application

Anti-RPS6KA5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

RPS6KA5 (Ribosomal protein S6 kinase α-5) plays an essential role in mitogen or stress-induced phosphorylation of transcription factors CREB1 and ATF1. It associates and phosphorylates p65, a subunit of NF-κB, at Ser276 leading to transcriptional activation of NF-κB-dependent gene expression. It regulates mitogen and stress-induced phosphorylation of histone H3 and high-mobility-group protein (HMG)-14 in association with mitogen and stress-activated protein kinase-2 (MSK2). The protein is involved in erythropoietin-induced serine 727 phosphorylation of STAT3 in association with MEK, ERK. It mediates the regulation of ER81 transcription factor, that is involved in ontogenesis and breast tumor formation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70505

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Albertus T J Wierenga et al.
Experimental hematology, 31(5), 398-405 (2003-05-24)
Erythropoietin (EPO) is a key regulator of erythropoiesis, playing a role in both the proliferation and differentiation of erythroid cells. One of the signal transduction molecules activated upon EPO stimulation is signal transducer and activator of transcription (STAT) 3. Besides
Ana Soloaga et al.
The EMBO journal, 22(11), 2788-2797 (2003-05-30)
Cells respond to mitogenic or stress stimuli by the rapid induction of immediate-early (IE) genes, which occurs concomitantly with the phosphorylation of histone H3 and the high-mobility-group protein HMG-14. In mammalian cells this response is mediated via ERK and p38
Ralf Janknecht
Oncogene, 22(5), 746-755 (2003-02-06)
The transcription factor ER81 has been shown to be involved in ontogenesis and breast tumor formation. ER81 is activated by many signals through phosphorylation directly mediated by mitogen-activated protein kinases (MAPKs), but also by an unknown protein kinase(s). Here, mitogen-
Linda Vermeulen et al.
The EMBO journal, 22(6), 1313-1324 (2003-03-12)
Nuclear factor kappaB (NF-kappaB) is one of the key regulators of transcription of a variety of genes involved in immune and inflammatory responses. NF-kappaB activity has long been thought to be regulated mainly by IkappaB family members, which keep the
Giselle R Wiggin et al.
Molecular and cellular biology, 22(8), 2871-2881 (2002-03-23)
Using mouse knockouts for mitogen- and stress-activated protein kinase 1 (MSK1) and MSK2 and a double knockout of both MSK1 and MSK2, we show that these protein kinases are required for the stress-induced phosphorylation of transcription factors CREB and ATF1

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service