A dilution of 1:200-1:500 is recommended for immunohistochemistry. The protocol can be found at the following link: https://www.sigmaaldrich.com/technical-documents/protocol/protein-biology/immunohistochemistry/immunohistochemistry-procedure. Citations using this antibody can be found at CiteAb: https://www.citeab.com/antibodies/1510734-hpa001909-anti-lamc1-antibody-produced-in-rabbit?des=
Select a Size
$607.00
$607.00
About This Item
Skip To
Product Name
Anti-LAMC1 antibody produced in rabbit, Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse
enhanced validation
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
immunogen sequence
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... LAMC1(3915)
Looking for similar products? Visit Product Comparison Guide
Related Categories
1 of 4
This Item | L1418 | HPA004056 | HPA014750 |
|---|---|---|---|
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| Quality Level 100 | Quality Level 200 | Quality Level 100 | Quality Level 100 |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| Gene Information human ... LAMC1(3915) | Gene Information human ... LAMP1(3916) | Gene Information human ... LAMB1(3912) | Gene Information human ... LAMP1(3916) |
Application
Disclaimer
Features and Benefits
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
General description
Immunogen
Other Notes
Physical form
Legal Information
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
-
Any recommendations on what dilution is best for human and mouse tissue IHC? and what blocking conditions. Any literature on this, other than protein atlas data?
1 answer-
Helpful?
-
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service


