MilliporeSigma
All Photos(5)

Documents

HPA005558

Sigma-Aldrich

Anti-KEAP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-Cytosolic inhibitor of Nrf2 antibody produced in rabbit, Anti-Kelch-like ECH-associated protein 1 antibody produced in rabbit, Anti-Kelch-like protein 19 antibody produced in rabbit
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KEAP1(9817)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MABC713ABS97HPA008701
vibrant-m

MABC713

Anti-KEAP1, clone 7G4B10 Antibody

vibrant-m

ABS97

Anti-KEAP1 Antibody

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

-

product line

Prestige Antibodies® Powered by Atlas Antibodies

antibody form

affinity isolated antibody

antibody form

purified antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

conjugate

unconjugated

conjugate

-

conjugate

-

conjugate

unconjugated

biological source

rabbit

biological source

mouse

biological source

rabbit

biological source

rabbit

shipped in

wet ice

shipped in

wet ice

shipped in

wet ice

shipped in

wet ice

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

The KEAP1 (kelch-like ECH-associated protein 1) gene encodes a protein containing an N-terminal BTB domain, a conserved linker domain, and a Kelch domain at the C-terminal. The gene is mapped to human chromosome 19p13.

Immunogen

Kelch-like ECH-associated protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The protein Keap1 (kelch-like ECH-associated protein 1) encoded by the gene KEAP1 negatively regulates Nrf2, a bZIP transcription factor involved in the induction of phase II detoxifying and oxidative stress enzyme genes, thus protecting cells from oxidative damage and maintaining cellular redox homeostasis. The encoded protein ubiquitinates Nrf2 by forming a functional E3 ubiquitin ligase complex with Cul3 and Rbx1. It increases the rate of proteasomal degradation of Nrf2 and also alters its subcellular distribution. Loss of keap1 function leads to increase in Nrf2 levels, which results in development of resistance to chemotherapeutic drugs in lung tumors. Mutations in this gene have been observed in NSCLC (Non-small-cell lung cancer).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86908

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Donna D Zhang et al.
Molecular and cellular biology, 24(24), 10941-10953 (2004-12-02)
The bZIP transcription factor Nrf2 controls a genetic program that protects cells from oxidative damage and maintains cellular redox homeostasis. Keap1, a BTB-Kelch protein, is the major upstream regulator of Nrf2 and controls both the subcellular localization and steady-state levels
K Itoh et al.
Genes & development, 13(1), 76-86 (1999-01-14)
Transcription factor Nrf2 is essential for the antioxidant responsive element (ARE)-mediated induction of phase II detoxifying and oxidative stress enzyme genes. Detailed analysis of differential Nrf2 activity displayed in transfected cell lines ultimately led to the identification of a new
Anju Singh et al.
PLoS medicine, 3(10), e420-e420 (2006-10-06)
Nuclear factor erythroid-2 related factor 2 (NRF2) is a redox-sensitive transcription factor that positively regulates the expression of genes encoding antioxidants, xenobiotic detoxification enzymes, and drug efflux pumps, and confers cytoprotection against oxidative stress and xenobiotics in normal cells. Kelch-like
Michael McMahon et al.
The Journal of biological chemistry, 278(24), 21592-21600 (2003-04-19)
Keap1 is a negative regulator of Nrf2, a bZIP transcription factor that mediates adaptation to oxidative stress. Previous studies suggested this negative regulation is a consequence of Keap1 controlling the subcellular distribution of Nrf2. We now report that Keap1 also
Pau B Esparza-Moltó et al.
PLoS biology, 19(5), e3001252-e3001252 (2021-05-14)
The mitochondrial ATP synthase emerges as key hub of cellular functions controlling the production of ATP, cellular signaling, and fate. It is regulated by the ATPase inhibitory factor 1 (IF1), which is highly abundant in neurons. Herein, we ablated or

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service