HPA005631

Sigma-Aldrich

Anti-DDX3X antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-DEAD box protein 3, Y-chromosomal antibody produced in rabbit, Anti-ATP-dependent RNA helicase DDX3Y antibody produced in rabbit
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, rat, human

packaging

antibody small pack of 25 μL

enhanced validation

independent
RNAi knockdown
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGG

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... DDX3X(1654)

Looking for similar products? Visit Product Comparison Guide

General description

DEAD (Asp-Glu-Ala-Asp) box helicase 3 (DDX3X) is an ATP-dependent RNA helicase. It has multiple conserved domains and has roles in both the nucleus and cytoplasm.

Immunogen

ATP-dependent RNA helicase DDX3Y recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

DEAD (Asp-Glu-Ala-Asp) box helicase 3 (DDX3X) has RNA-unwinding and adenosine triphosphatase (ATPase) activities. The other functions include nuclear mRNA export, cell growth control and cancer progression. The ATPase activity of the helicase is stimulated by various ribo- and deoxynucleic acids. Studies with different nucleoside triphosphate analogs showed that the human DDX3 ATPase has high catalytic efficiency and rather relaxed substrate specificity, both in terms of base selection and sugar selection. It has an ability to recognize the L-stereoisomers of both 3′ deoxy- and 2′, 3′ dideoxy-ribose, showing it has low stereo selectivity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74303.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Raffaella Franca et al.
Proteins, 67(4), 1128-1137 (2007-03-16)
Human DDX3 (hDDX3) is a DEAD-box protein shown to possess RNA-unwinding and adenosine triphosphatase (ATPase) activities. The hDDX3 protein has been implicated in nuclear mRNA export, cell growth control, and cancer progression. In addition, a role of this protein in...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service