HPA005659

Sigma-Aldrich

Anti-NSD3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-WHISTLE, Anti-WHSC1-like 1 isoform 9 with methyltransferase activity to lysine antibody produced in rabbit, Anti-Whistle antibody produced in rabbit, Anti-FLJ20353, Anti-WHSC1L1, Anti-Histone-lysine N-methyltransferase NSD3 antibody produced in rabbit, Anti-Wolf-Hirschhorn syndrome candidate 1-like protein 1 antibody produced in rabbit, Anti-Nuclear SET domain-containing protein 3 antibody produced in rabbit, Anti-KMT3F, Anti-WHSC1-like protein 1 antibody produced in rabbit
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

MMRCLRCPVAYHSGDACIAAGSMLVSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEKGGRLLCCESCPASFHPECLSIEMPEGCWNC

conjugate

unconjugated

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... WHSC1L1(54904)

General description

Wolf-Hirschhorn syndrome candidate 1-like 1 (WHSC1L1) is a protein containing 700 amino acids, a SET domain and PHD finger. The gene encoding it has 23 coding exons and spans more than 90kb of genomic DNA.

Immunogen

nuclear receptor binding SET domain protein 3 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

Wolf-Hirschhorn syndrome candidate 1-like 1 (WHSC1L1) has an important role in embryonic development and in cancer development, when it functions abnormally. It has a histone methyltransferase activity. WHSC1L1 methylates Lys-4 and Lys-27 of histone H3. H3 Lys-4 methylation represents a tag for epigenetic transcriptional activation, while Lys-27 marks for transcriptional repression. It forms a complex with lysine demethylase 2 (LSD2) and G9a (a H3K9-specific methyltransferase) in vivo and localizes to the gene bodies of actively transcribed genes. These together coordinate modifications at H3K4, H3K9, and H3K36 during elongation for optimal transcription.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85173.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Sung Mi Kim et al.
Biochemical and biophysical research communications, 345(1), 318-323 (2006-05-10)
Evolutionary conserved SET domains were originally identified in three Drosophila proteins: suppressor of variegation (Su (var) 3-9), enhancer of zeste (E(z)), and the trithorax. Some of the SET-domain containing proteins have been known to elicit methylation of histone lysine residues....
P O Angrand et al.
Genomics, 74(1), 79-88 (2001-05-26)
We describe the isolation and characterization of NSD3, the third member of a gene family including Nsd1 and NSD2. Murine Nsd1 was isolated in a search for proteins that interact with the ligand-binding domain of retinoic acid receptor alpha. NSD2...
Chao He et al.
The Journal of biological chemistry, 288(7), 4692-4703 (2012-12-28)
The NSD (nuclear receptor SET domain-containing) family members, consisting of NSD1, NSD2 (MMSET/WHSC1), and NSD3 (WHSC1L1), are SET domain-containing methyltransferases and aberrant expression of each member has been implicated in multiple diseases. They have specific mono- and dimethylase activities for...
I Stec et al.
Genomics, 76(1-3), 5-8 (2001-09-11)
We have identified and characterized a gene (60% on protein level) and a pseudogene (93% on DNA level) that show high similarity to the Wolf-Hirschhorn syndrome candidate gene-1 (WHSC1). These genes, WHSC1L1 and WHSC1L2P, map to human chromosomes 8p11.2 and...
null

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.