All Photos(2)

HPA005688

Sigma-Aldrich

Anti-CASP8 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Apoptotic protease Mch-5, Anti-FADD-like ICE, Anti-CAP4, Anti-CASP-8, Anti-Apoptotic cysteine protease, Anti-Caspase-8 precursor, Anti-MACH, Anti-FADD-homologous ICE/CED-3-like protease, Anti-ICE-like apoptotic protease 5, Anti-FLICE, Anti-MORT1-associated CED-3 homolog
MDL number:
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CASP8(841)

General description

Caspase 8 (CASP8) is a cysteine protease, belonging to the cysteine-aspartic acid protease (caspase) family.

Immunogen

Caspase-8 precursor recombinant protein epitope signature tag (PrEST)

Sequence
LGEGKLDILKRVCAQINKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICC

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Caspase 8 (CASP8) is the first protease of the activation cascade of caspases responsible for the tumor necrosis factor receptor superfamily member 6 (TNFRSF6/FAS) mediated and tumor necrosis factor receptor superfamily member F1A (TNFRSF1A) induced cell death. After binding to the adapter molecule, Fas-associated via death domain (FADD) recruits it to a receptor. This results in the formation of an aggregation called death-inducing signaling complex (DISC) which carries out the proteolytic activation of CASP8. Then its active dimeric form is liberated from the DISC and activates downstream apoptotic proteases. It then cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. CASP8 also participates in Granzyme (GZMB) apoptotic pathways. It hydrolyzes a small-molecule substrate, Ac-Asp-Glu-Val-Asp-AMC.CASP8 is a modulator of p85a Rab-GAP activity and endosomal trafficking. The interaction between it and p85a causes Rab5 GTP loading, changes endosomal trafficking and at the edge of the cell, Rab5-positive endosomes are seen.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78230.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

Certificate of Analysis

Certificate of Origin

Vicente A Torres et al.
The Journal of biological chemistry, 283(52), 36280-36289 (2008-11-01)
Caspase 8 is a cysteine protease that initiates apoptotic signaling via the extrinsic pathway in a manner dependent upon association with early endosomes. Previously, we identified caspase 8 as an effector of migration, promoting motility in a manner dependent upon...
Silvia Márquez-Jurado et al.
Nature communications, 9(1), 389-389 (2018-01-28)
Fractional killing is the main cause of tumour resistance to chemotherapy. This phenomenon is observed even in genetically identical cancer cells in homogeneous microenvironments. To understand this variable resistance, here we investigate the individual responses to TRAIL in a clonal...
M Muzio et al.
The Journal of biological chemistry, 272(5), 2952-2956 (1997-01-31)
Engagement of CD95 or tumor necrosis factor 1 receptor (TNFR-1) by ligand or agonist antibodies is capable of activating the cell death program, the effector arm of which is composed of mammalian interleukin-1beta converting enzyme (ICE)-like cysteine proteases (designated caspases)...
Xiao Yang Wang et al.
Clinical & experimental ophthalmology, 42(6), 529-538 (2013-11-15)
The aim of the study was to investigate, using a native mitomycin-C-resistant human Tenon's fibroblast cell line, the possibility that interferon-alpha and gamma could be used with Fas agonists as an alternative anti-fibrotic strategy to mitomycin-C in trabeculectomy. A clinically...
Hanghui Wang et al.
International journal of oncology, 45(1), 157-164 (2014-04-17)
The specific and efficient delivery of small interfering RNA (siRNA) into cancer cells in vivo remains a major obstacle. In this study, we investigated whether ultrasound-targeted microbubble destruction (UTMD) combined with dual targeting of HSP72 and HSC70 in prostate cancer cell...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service