HPA006353

Sigma-Aldrich

Anti-SCUBE2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Signal peptide, CUB and EGF-like domain-containing protein 2, Anti-Protein CEGP1
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

ESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSC

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SCUBE2(57758)

General description

SCUBE2 (signal peptide, CUB domain, EGF-like 2) was originally recognized in endothelium and multiple nonendothelial primary cell types. In normal breasts, it is expressed in vascular endothelial and mammary ductal epithelial cells. It is a member of the evolutionary conserved small family called SCUBE. This family contains three members. SCUBe2 contains around five motifs namely, a leader peptide in its N-terminal, nine tandem EGF-like repeats, a large spacer region which is N-glycosylated, three repeated stretches of 6-cysteine residues, and a C-terminal with one CUB domain.

Immunogen

Signal peptide, CUB and EGF-like domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

SCUBE2 (signal peptide, CUB domain, EGF-like 2) shows aberrant expression in breast cancer, and plays a role in tumorigenesis. It inhibits breast cancer cell proliferation, and its expression is linked to good prognosis. Thus, it might have potential as a marker for breast cancer. It inhibits breast tumor growth by acting as negative regulator of BMP (bone morphogenetic protein), and inhibiting the β-catenin pathway. It also prevents breast tumor invasion and migration by inhibiting epithelial-mesenchymal transition.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70280.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Yuh-Charn Lin et al.
Journal of cell science, 127(Pt 1), 85-100 (2013-11-12)
Signal peptide-CUB-EGF domain-containing protein 2 (SCUBE2) belongs to a secreted and membrane-associated multi-domain SCUBE protein family. We previously demonstrated that SCUBE2 is a novel breast-tumor suppressor and could be a useful prognostic marker. However, the role of SCUBE2 in breast-cancer...
Yuh-Charn Lin et al.
The Journal of biological chemistry, 286(30), 27039-27047 (2011-06-10)
Signal peptide CUB (complement proteins C1r/C1s, Uegf, and Bmp 1)-EGF domain-containing protein 2 (SCUBE2) is a secreted, membrane-associated multidomain protein composed of five recognizable motifs: an NH(2)-terminal signal peptide sequence, nine copies of epidermal growth factor (EGF)-like repeats, a spacer...
Chien-Jui Cheng et al.
Cancer research, 69(8), 3634-3641 (2009-04-17)
Signal peptide-CUB-epidermal growth factor-like domain-containing protein 2 (SCUBE2), originally identified from the endothelium and several nonendothelial primary cell types, was recently shown to be expressed in invasive breast carcinomas. However, the protein localization and biological significance of SCUBE2 in breast...
Petra Jakobs et al.
Journal of cell science, 127(Pt 8), 1726-1737 (2014-02-14)
All morphogens of the Hedgehog (Hh) family are synthesized as dual-lipidated proteins, which results in their firm attachment to the surface of the cell in which they were produced. Thus, Hh release into the extracellular space requires accessory protein activities....
Toshima Z Parris et al.
International journal of cancer, 134(7), 1617-1629 (2013-10-12)
The deregulation of key cellular pathways is fundamental for the survival and expansion of neoplastic cells, which in turn can have a detrimental effect on patient outcome. To develop effective individualized cancer therapies, we need to have a better understanding...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.