Skip to Content
MilliporeSigma

HPA008862

Anti-LONP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-peroxisomal LON protease-like antibody produced in rabbit


Sign In to View Organizational & Contract Pricing.

Select a Size

100 μL

$667.00

$667.00


Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:

Skip To

Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-LONP2 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... LONP2(83752)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB4503299SAB1411647HPA036396
conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

purified immunoglobulin

antibody form

affinity isolated antibody

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

-

product line

Prestige Antibodies® Powered by Atlas Antibodies

UniProt accession no.

Q86WA8

UniProt accession no.

Q86WA8

UniProt accession no.

P36776

UniProt accession no.

Q13094

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

LONP2 (lon peptidase 2) controls the β-oxidation of fatty acids in peroxisomes, in coordination with trypsin domain-containing 1 (Tysnd1). It degrades the self-cleaved C- and N-terminal products of Tysnd1 protein. Thus, it controls the turnover and activity of Tysnd1 enzyme, thereby indirectly controlling peroxisomal fatty acid β-oxidation. In mitochondria, this enzyme is responsible for the degradation of folded protein and promotes non-processive substrate cleavage. This enzyme is thought to play a key role in the synthesis of peroxisomes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

LONP2 (lon peptidase 2) is a peroxisomal matrix protein, which contains a serine protease-like domain and a peroxisome-targeting signal 1 (PTS1) region. It belongs to the ATP-dependent Lon protease family. This protein is composed of 852 amino acids and has a molecular weight of 90kDa.

Immunogen

peroxisomal LON protease-like recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST70788

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Miki Kikuchi et al.
The Journal of biological chemistry, 279(1), 421-428 (2003-10-17)
Subcellular proteomics, which includes isolation of subcellular components prior to a proteomic analysis, is advantageous not only in characterizing large macro-molecular complexes such as organelles but also in elucidating mechanisms of protein transport and organelle biosynthesis. Because of the high
Kanji Okumoto et al.
The Journal of biological chemistry, 286(52), 44367-44379 (2011-10-18)
The molecular mechanisms underlying protein turnover and enzyme regulation in the peroxisomal matrix remain largely unknown. Trypsin domain-containing 1 (Tysnd1) and peroxisomal Lon protease (PsLon) are newly identified peroxisomal matrix proteins that harbor both a serine protease-like domain and a
Gabriela Ondrovicová et al.
The Journal of biological chemistry, 280(26), 25103-25110 (2005-05-05)
Mechanistic studies of ATP-dependent proteolysis demonstrate that substrate unfolding is a prerequisite for processive peptide bond hydrolysis. We show that mitochondrial Lon also degrades folded proteins and initiates substrate cleavage non-processively. Two mitochondrial substrates with known or homology-derived three-dimensional structures

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service