HPA008960

Sigma-Aldrich

Anti-TMED7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-CGI-109, Anti-FLJ90481
Human Protein Atlas Number:
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TMED7(51014)

General description

Anti-TMED7-TICAM2 antibody functions against proteins from two different genes namely, TMED7 (transmembrane p24 trafficking protein 7) and TICAM2 (toll like receptor adaptor molecule 2). TMED7 is a glycoprotein and a member of the small transmembrane secretory pathway protein family called p24, which is found abundantly in cells. This protein localizes to the cis-Golgi and COPI and COPII-coated vesicles in the cytosol. TICAM2, also known as TRIF-related adaptor molecule (TRAM), contains a bipartite amino-terminal myristoylation motif and polybasic domain. It localizes to both cell membrane and endosomal membranes.

Immunogen

transmembrane emp24 protein transport domain containing 7

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

TMED7 (transmembrane p24 trafficking protein 7) plays an essential role in the trafficking of TLR (toll like receptor) 4 from the ER (endoplasmic reticulum) through the Golgi apparatus, to the plasma membrane. However, this protein suppresses TLR4 signaling, upon encountering lipopolysaccharide (LPS), which forms an essential component of Gram-negative bacterial cell wall. TICAM2 (toll like receptor adaptor molecule 2) is a toll like receptor adaptor which plays a key role in TLR4-mediated immune responses. Polymorphisms in this gene are linked with susceptibility to tuberculosis. It also plays a key role in the production of RANTES (regulated on activation, normal T cell expressed and secreted), in a TLR7-mediated manner.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71941.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Noémi Borsay Hall et al.
Genes and immunity, 16(2), 127-133 (2014-12-19)
Human genetic susceptibility for tuberculosis (TB) has been demonstrated by several studies, but few have examined the multiple innate and adaptive immunity genes comprehensively, age-specific effects and/or resistance to Mycobacterium tuberculosis (Mtb) infection (resistors (RSTRs)). We hypothesized that RSTRs, defined...
J Füllekrug et al.
Molecular biology of the cell, 10(6), 1939-1955 (1999-06-08)
We report here the characterization of gp27 (hp24gamma3), a glycoprotein of the p24 family of small and abundant transmembrane proteins of the secretory pathway. Immunoelectron and confocal scanning microscopy show that at steady state, gp27 localizes to the cis side...
Sarah L Doyle et al.
Nature communications, 3, 707-707 (2012-03-20)
Toll-like receptor 4 is an innate immune receptor responsible for the recognition of the Gram-negative cell wall component lipopolysaccharide. Here we show that transmembrane emp24 domain-containing protein 7 (TMED7) inhibits MyD88-independent toll-like receptor 4 signalling. TMED7 overexpression inhibits the ability...
The COP II adaptor protein TMED7 is required to initiate and mediate the delivery of TLR4 to the plasma membrane.
Liaunardy-Jopeace A, Bryant CE, and Gay NJ
Science Signaling, 7(336), ra70-ra70 (2014)
Julianne Stack et al.
Journal of immunology (Baltimore, Md. : 1950), 193(12), 6090-6102 (2014-11-12)
Detection of microbes by TLRs on the plasma membrane leads to the induction of proinflammatory cytokines such as TNF-α, via activation of NF-κB. Alternatively, activation of endosomal TLRs leads to the induction of type I IFNs via IFN regulatory factors...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.