HPA011410

Sigma-Aldrich

Anti-PEX2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Peroxisomal membrane protein 3, Anti-Peroxin-2, Anti-35 kDa peroxisomal membrane protein, Anti-PAF-1, Anti-PXMP3, Anti-Peroxisome assembly factor 1, Anti-RING finger protein 72
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

NAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQ

conjugate

unconjugated

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PXMP3(5828)

Immunogen

Peroxisome assembly factor 1 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

PEX2 (peroxisomal biogenesis factor 2) is a peroxisomal integral membrane protein belonging to the zinc finger protein family. This 35kDa protein consists of two transmembrane regions and a zinc RING domain at the C-terminus cytoplasmic end. It is majorly involved in the biogenesis of peroxisome. During synthesis, it translocates peroxisomal matrix protein after synthesizing on free cytosolic ribosomes. Later, it is moved to the peroxisome membrane. Mutation in the peroxisome synthesis causes a peroxisome biogenesis disorder (PBD) called Zellweger syndrome.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72155.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

A Fedick et al.
Clinical genetics, 85(4), 343-346 (2013-04-18)
Zellweger syndrome is known to be caused by numerous mutations that occur in at least 12 of the PEX genes. While phenotypes vary, many are severely debilitating, and death can result in affected newborns. Since the disease follows an autosomal...
Martina Biermanns et al.
European journal of cell biology, 82(4), 155-162 (2003-05-20)
Peroxin 2 (PEX2) is a 35-kDa integral peroxisomal membrane protein with two transmembrane regions and a zinc RING domain within its cytoplasmically exposed C-terminus. Although its role in peroxisome biogenesis and function is poorly understood, it seems to be involved...
Qingyu Huang et al.
Journal of applied toxicology : JAT, 34(12), 1342-1351 (2013-12-05)
Perfluorooctane sulfonate (PFOS) is one of the most commonly used perfluorinated compounds, whose environmental exposure has been associated with a number of adverse health outcomes. However, the molecular mechanisms involved in PFOS toxicity are still not well elucidated. In the...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.