MilliporeSigma
All Photos(7)

Documents

HPA011562

Sigma-Aldrich

Anti-TOMM20 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-Mitochondrial 20 kDa outer membrane protein antibody produced in rabbit, Anti-Mitochondrial import receptor subunit TOM20 homolog antibody produced in rabbit, Anti-Outer mitochondrial membrane receptor Tom20 antibody produced in rabbit
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human

packaging

antibody small pack of 25 μL

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TOMM20(9804)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MABT166WH0009804M1T6319
conjugate

unconjugated

conjugate

-

conjugate

unconjugated

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody form

purified antibody

antibody form

purified immunoglobulin

antibody form

purified from hybridoma cell culture

clone

polyclonal

clone

2F8.1, monoclonal

clone

4F3, monoclonal

clone

1C9-2, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

-

product line

-

form

buffered aqueous glycerol solution

form

-

form

buffered aqueous solution

form

buffered aqueous solution

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Translocase of outer mitochondrial membrane 20 (TOMM20) is mapped to human chromosome 1q42.3. It comprises a N-terminal hydrophobic transmembrane (TM) segment and cytosol exposed C-terminal domain. TOMM20 also has glutamine rich acidic regions and a tetratrico peptide repeat (TPR).

Immunogen

Mitochondrial import receptor subunit TOM20 homolog recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-TOMM20 antibody produced in rabbit has been used in:
  • western blotting
  • confocal laser microscopy
  • immunofluorescence

Anti-TOMM20 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

TOMM20 (Translocase of outer mitochondrial membrane 20) is a major mitochondrial protein receptor involved in the cytosolic protein import phenomena. It is localized in the cytoplasm of spiral ganglia neurons. It functions as a subunit of a protein import complex to identify and translocate specific cytosolic proteins into the mitochondrial outer membrane. Study shows that TOMM20 acts as a biomarker in identifying the mitochondrial mass and oxidative phosphorylation in several cancer types.
TOMM20 anchors on the mitochondrial outer membrane via its N-terminal domain. The C-terminal region functions as a receptor for mitochondrial precursor proteins. The tetratrico peptide repeat (TPR) mediates protein-protein interactions. TOMM20 interacts with α-synuclein leading to the inhibition of mitochondrial protein import. Aberration in this interaction is implicated in the pathogenesis of Parkinson′s disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72221.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Customers Also Viewed

alpha-Synuclein binds to TOM20 and inhibits mitochondrial protein import in Parkinson?s disease
DiM, et al.
Science Translational Medicine, 8(342), 342-342 (2016)
Ciprofloxacin impairs mitochondrial DNA replication initiation through inhibition of Topoisomerase 2
Hangas A, et al.
Nucleic Acids Research, 46(18), 9625-9636 (2018)
Hodgkin Lymphoma: Metabolic Symbiosis Between Malignant Cells and Cancer-Associated Stromal Tissue
Blood, 122(21), 2993-2993 null
Kathryn Taggart et al.
BioResearch open access, 6(1), 182-191 (2017-12-30)
The Doberman pinscher (DP) canine breed displays a high incidence of idiopathic, nonischemic dilated cardiomyopathy (DCM) with increased mortality. A common mutation in DPs is a splice site deletion in the pyruvate dehydrogenase kinase 4 (PDK4) gene that shows a
Novel genetic locus implicated for HIV-1 acquisition with putative regulatory links to HIV replication and infectivity: A genome-wide association study
Saccone NL, et al.
Testing (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service