All Photos(5)

HPA016952

Sigma-Aldrich

Anti-USP30 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Deubiquitinating enzyme 30, Anti-Ubiquitin-specific-processing protease 30, Anti-Ubiquitin thioesterase 30, Anti-Ubiquitin carboxyl-terminal hydrolase 30
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... USP30(84749)

General description

USP30 (ubiquitin specific peptidase 30) is a deubiquitinating protein localized in the outer membrane of mitochondria.
USP30 is encoded by the gene mapped to human chromosome 12q24.11. The encoded protein belongs to the ubiquitin-specific protease family.

Immunogen

Ubiquitin carboxyl-terminal hydrolase 30 recombinant protein epitope signature tag (PrEST)

Application

Anti-USP30 antibody produced in rabbit has been used in western blotting.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

USP30 (ubiquitin specific peptidase 30) is involved in the maintenance of mitochondrial morphology through the deubiquitination. It has been reported that USP30 plays an important role in the Parkinson′s disease. Overexpressed USP30 generates damaged mitochondria and blocks parkin′s ability to mediate mitophagy by removing parkin attached ubiquitin. On the other end, reduced activity of USP30 causes enhanced mitochondrial degradation in neurons. Research data has concluded that inhibited expression of USP30 plays a positive role in the Parkinson′s disease by promoting mitochondrial clearance and quality control.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70812.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

Certificate of Analysis

Certificate of Origin

Yusuke Sato et al.
Nature structural & molecular biology, 24(11), 911-919 (2017-09-26)
Parkin ubiquitin (Ub) ligase (also known as PARK2) ubiquitinates damaged mitochondria for their clearance and quality control. USP30 deubiquitinase opposes parkin-mediated Ub-chain formation on mitochondria by preferentially cleaving Lys6-linked Ub chains. Here, we report the crystal structure of zebrafish USP30...
Structural basis for specific cleavage of Lys6-linked polyubiquitin chains by USP30
Sato Y, et al.
Nature Structural and Molecular Biology, 24(11), 911-911 (2017)
Dual role of USP30 in controlling basal pexophagy and mitophagy
Marcassa E, et al.
EMBO Reports, 19(7) (2018)
Mechanism and regulation of the Lys6-selective deubiquitinase USP30
Gersch M, et al.
Nature Structural and Molecular Biology, 24(11), 920-920 (2017)
A genome-wide study reveals rare CNVs exclusive to extreme phenotypes of Alzheimer disease
Rovelet-Lecrux A, et al.
European Journal of Human Genetics, 20(6), 613-617 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service