HPA017749

Sigma-Aldrich

Anti-ADCY10 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-Adenylate cyclase homolog, Anti-Testicular soluble adenylyl cyclase, Anti-AH-related protein, Anti-sAC, Anti-Germ cell soluble adenylyl cyclase, Anti-hsAC, Anti-Adenylate cyclase type 10
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

RNTTYIVIGAVQPNDISNKICLDLNVSCISKELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEKLNMVTLHSDKESEEVCHLTSGVRLKNLSPPTSLKEISLI

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ADCY10(55811)

General description

Adenylate cyclase type 10 (ADCY10) belongs to the cyclase class III family. It is present in the cytoplasm, mitochondria and nucleus.

Immunogen

Adenylate cyclase type 10 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

Adenylate cyclase type 10 (ADCY10) controls the functions of mammalian complex I, which is part of the respiratory chain, and the turnover of its subunits. ADCY10 catalyzes the formation of cyclic adenosine monophosphate (cAMP). It has been shown that ADCY10 is involved in the regulation of basal cyclic nucleotide monophosphates (cNMP) levels and since ADCY10 is activated by bicarbonate ions, it functions as a cellular sensor for bicarbonate ions, carbon dioxide and pH. This protein controls oxidative phosphorylation in mitochondria and activates the apoptotic pathway. Studies have shown that ADCY10 is up-regulated in prostate carcinomas.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72897.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Jacob L Bitterman et al.
The Journal of pharmacology and experimental therapeutics, 347(3), 589-598 (2013-10-05)
The second messenger cAMP is involved in a number of cellular signaling pathways. In mammals, cAMP is produced by either the hormonally responsive, G protein-regulated transmembrane adenylyl cyclases (tmACs) or by the bicarbonate- and calcium-regulated soluble adenylyl cyclase (sAC). To...
Jan-Paul Flacke et al.
The Journal of biological chemistry, 288(5), 3126-3135 (2012-12-21)
cAMP signaling plays an essential role in modulating the proliferation of different cell types, including cancer cells. Until now, the regulation of this pathway was restricted to the transmembrane class of adenylyl cyclases. In this study, significant overexpression of soluble...
Silke Kleinboelting et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(10), 3727-3732 (2014-02-26)
cAMP is an evolutionary conserved, prototypic second messenger regulating numerous cellular functions. In mammals, cAMP is synthesized by one of 10 homologous adenylyl cyclases (ACs): nine transmembrane enzymes and one soluble AC (sAC). Among these, only sAC is directly activated...
Silke Kleinboelting et al.
The FEBS journal, 281(18), 4151-4164 (2014-07-22)
The ubiquitous second messenger cAMP regulates a wide array of functions, from bacterial transcription to mammalian memory. It is synthesized by six evolutionarily distinct adenylyl cyclase (AC) families. In mammals, there are two AC types: nine transmembrane ACs (tmACs) and...
Alan Hasan et al.
Biochemical and biophysical research communications, 448(2), 236-240 (2014-05-06)
Intact HEK293 cells and B103 neuroblastoma cells possess high basal concentrations of the established second messengers cAMP and cGMP and of the emerging second messengers cCMP and cUMP. We asked the question which nucleotidyl cyclase accounts for the high basal...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.