HPA018893

Sigma-Aldrich

Anti-NSD3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-WHISTLE, Anti-Wolf-Hirschhorn syndrome candidate 1-like protein 1, Anti-Nuclear SET domain-containing protein 3, Anti-WHSC1-like protein 1, Anti-Whistle, Anti-FLJ20353, Anti-WHSC1L1, Anti-Histone-lysine N-methyltransferase NSD3, Anti-KMT3F
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

NTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATS

conjugate

unconjugated

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... WHSC1L1(54904)

General description

The gene WHSC1L1 (Wolf-Hirschhorn syndrome candidate 1-like protein 1) is mapped to human chromosome 8p11.2. The protein contains methyltransferase SET domain and the PHD (plant homeodomain) finger. WHSC1L1 is also called as NSD3 (nuclear SET domain-containing protein 3).

Immunogen

nuclear receptor binding SET domain protein 3 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

Wolf-Hirschhorn syndrome candidate 1-like protein 1 (WHSC1L1) is a histone methyltransferase. Bromodomain protein 4 (BRD4) interacts with WHSC1L1 and thereby regulates transcriptional activity. WHSC1L1 modulates transcription by controlling histone-3 lysine-36 (H3K36) methylation. WHSC1L1 is up-regulated in tumor cell lines, bladder, lung, liver cancer and primary breast carcinoma. It is important for cell cycle progression at mitosis. WHSC1L1-NUT (nuclear protein in testis) fusion protein is associated with NUT (nuclear protein of the testis) midline carcinoma.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85172.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Daechun Kang et al.
Genes, chromosomes & cancer, 52(2), 126-139 (2012-09-27)
Histone lysine methylation plays a fundamental role in chromatin organization. Although a set of histone methyltransferases have been identified and biochemically characterized, the pathological roles of their dysfunction in human cancers are still not well understood. In this study, we...
P O Angrand et al.
Genomics, 74(1), 79-88 (2001-05-26)
We describe the isolation and characterization of NSD3, the third member of a gene family including Nsd1 and NSD2. Murine Nsd1 was isolated in a search for proteins that interact with the ligand-binding domain of retinoic acid receptor alpha. NSD2...
Christopher A French et al.
Cancer discovery, 4(8), 928-941 (2014-05-31)
NUT midline carcinoma (NMC) is an aggressive subtype of squamous cell carcinoma that typically harbors BRD4/3-NUT fusion oncoproteins that block differentiation and maintain tumor growth. In 20% of cases, NUT is fused to uncharacterized non-BRD gene(s). We established a new...
I Stec et al.
Genomics, 76(1-3), 5-8 (2001-09-11)
We have identified and characterized a gene (60% on protein level) and a pseudogene (93% on DNA level) that show high similarity to the Wolf-Hirschhorn syndrome candidate gene-1 (WHSC1). These genes, WHSC1L1 and WHSC1L2P, map to human chromosomes 8p11.2 and...
Shaila Rahman et al.
Molecular and cellular biology, 31(13), 2641-2652 (2011-05-11)
Bromodomain protein 4 (Brd4) plays critical roles in development, cancer progression, and virus-host pathogenesis. To gain mechanistic insight into the various biological functions of Brd4, we performed a proteomic analysis to identify and characterize Brd4-associated cellular proteins. We found that...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.