HPA019885

Sigma-Aldrich

Anti-IL17RC antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-IL-17RC, Anti-Interleukin-17 receptor C, Anti-IL-17 receptor C, Anti-Interleukin-17 receptor homolog, Anti-Interleukin-17 receptor-like protein, Anti-IL-17RL, Anti-IL17Rhom
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

WDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNH

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IL17RC(84818)

Related Categories

General description

IL17RC (Interleukin 17 receptor C) is a novel single-pass transmembrane protein belonging to the interleukin-17 cytokine family. It is expressed in T cells and B cells with an extracellular N terminal domain. It is widely distributed in prostate, cartilage, kidney, liver, heart, and muscle, whereas at a lower level in thymus and leukocytes. It is mapped on human chromosome 3p25.3-3p24.1. Its expression has also been found in various cancerous cells such as prostate cancer.

Immunogen

Interleukin-17 receptor C Precursor recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

IL17RC (Interleukin 17 receptor C) is involved in the cytokine signaling pathway as a decoy receptor. It is essentially required for the signaling of IL-17A, IL-17F, and IL-17A/F both in vitro and in vivo. In nonhemopoietic tissues, it couples with IL-17RA and forms a complex, which drives the functions of IL-17A and IL-17F homodimers as well as IL-17A/F heterodimers. Inherited deficiency of IL17RC causes an autosomal recessive disorder, chronic mucocutaneous candidiasis (CMC), with recurrent or persistent infections of the skin, nail, oral, and genital mucosae.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72212.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Yan Hu et al.
Journal of immunology (Baltimore, Md. : 1950), 184(8), 4307-4316 (2010-03-17)
It has been suggested that IL-17RC forms a complex with IL-17RA to mediate the functions of IL-17A and IL-17F homodimers as well as IL-17A/F heterodimers. It is still unclear whether IL-17RC is absolutely required for the signaling of IL-17 cytokines...
Dominik Haudenschild et al.
The Journal of biological chemistry, 277(6), 4309-4316 (2001-11-14)
Members of the interleukin-17 cytokine family are present in a variety of tissues (1-3), although the founding member, interleukin-17, is expressed exclusively in T cells and B cells (4-8). The cloning and characterization of a novel single-pass transmembrane protein with...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.