HPA027999

Sigma-Aldrich

Anti-ATPIF1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-MGC1167, Anti-IP, Anti-MGC14836, Anti-CG7943, Anti-MGC8898, Anti-ATPIP, Anti-ATPI, Anti-ATPase inhibitory factor 1
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK

conjugate

unconjugated

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ATPIF1(93974)

General description

ATPase inhibitory factor 1 (ATPIF1) is an 81 amino acid mitochondrial protein. The gene encoding it is localized on human chromosome 1.

Immunogen

ATPase inhibitory factor 1 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

ATPase inhibitory factor 1 (ATPIF1) inhibits the hydrolase activity of the F1 subunit of the F1F0-ATPase complex during states of hypoxia. It is upregulated in carcinomas. The protein inhibits oxidative phosphorylation and modulates aerobic glycolysis in human mesenchymal stem cells. ATPIF1 is also associated with ATP synthase dimerization and has a role in modulating mitochondrial cristae density.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76729.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Mitochondrial Atpif1 regulates heme synthesis in developing erythroblasts
Dhvanit
Nature (2012)
The potential role of mitochondrial ATP synthase inhibitory factor 1 (IF1) in coronary heart disease: a literature review
Serban M, et.la
Lipids in Health and Disease (2017)
Inhibition of ATPIF1 ameliorates severe mitochondrial respiratory chain dysfunction in mammalian cells
Cell Reports (2014)
A tool to facilitate clinical biomarker studies - a tissue dictionary based on the Human Protein Atlas
Caroline Kampf
BMC Medicine (2012)
Serum IF1 concentration is independently associated to HDL levels and to coronary heart disease: the GENES study[S]
Annelise G
Journal of Lipid Research (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.