All Photos(1)

HPA049830

Sigma-Aldrich

Anti-KRAS antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-KRAS1, Anti-KRAS2
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

application(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV

conjugate

unconjugated

Featured Industry

Research Pathology

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KRAS(3845)

General description

Kirsten rat sarcoma-2 virus oncogene (KRAS), also known as c-K-Ras, is encoded by the gene mapped to human chromosome 12p12.1. It is a small GTP-binding protein. Alternative splicing of this gene results in two variants namely, KRASA and KRASB (KRAS proto-oncogenes). Expression of KRASA is restricted to specific tissues, whereas KRASB is ubiquitously expressed.

Immunogen

Kirsten rat sarcoma viral oncogene homolog

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Kirsten rat sarcoma-2 virus oncogene (KRAS) plays a vital role in signaling pathways. Mutation in the gene is associated with the development of early rectal cancer and colorectal cancer (CRC). Thus, it acts as a potential predictive biomarker in CRC.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84551.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Prognostic value of KRAS codon 13 gene mutation for overall survival in colorectal cancer: Direct and indirect comparison meta-analysis.
Kwak M S, et al.
Medicine, 96(35) (2017)
The prognostic value of KRAS mutation by cell-free DNA in cancer patients: a systematic review and meta-analysis.
Zhuang R, et al.
PLoS ONE, 12(8), e0182562-e0182562 (2017)
Wild-type KRAS is required for panitumumab efficacy in patients with metastatic colorectal cancer
Amado RG, et al.
Journal of Clinical Oncology, 26(10), 1626-1634 (2008)
KRAS Mutant Status May Be Associated with Distant Recurrence in Early-stage Rectal Cancer
Sideris M, et al.
Anticancer Research, 37(3), 1349-1357 (2017)
The RASopathies: developmental syndromes of Ras/MAPK pathway dysregulation
Tidyman WE and Rauen KA
Current Opinion in Genetics & Development, 19(3), 230-236 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service