HPA049949
rabbit
unconjugated
affinity isolated antibody
primary antibodies
polyclonal
Prestige Antibodies® Powered by Atlas Antibodies
buffered aqueous glycerol solution
human
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK
wet ice
−20°C
human ... CCT6A(908)
1 of 4
This Item | SAB4503547 | HPA042996 | HPA045576 |
---|---|---|---|
biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
clone polyclonal | clone polyclonal | clone polyclonal | clone polyclonal |
product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
form buffered aqueous glycerol solution | form buffered aqueous solution | form buffered aqueous glycerol solution | form buffered aqueous glycerol solution |
10 - Combustible liquids
WGK 1
Not applicable
Not applicable
Enter Lot Number to search for Certificate of Analysis (COA).
Enter Lot Number to search for Certificate of Origin (COO).
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service