MilliporeSigma
All Photos(2)

MSQC22

Sigma-Aldrich

SILuLite SigmaMAb Trastuzumab Monoclonal Antibody

recombinant, expressed in CHO cells

Synonym(s):
Mass spectrometry standard, Tratuzumab

recombinant

expressed in CHO cells

assay

≥90% (SDS-PAGE)

form

solid

suitability

suitable for mass spectrometry

shipped in

wet ice

storage temp.

−20°C

Related Categories

General description

SigmaMAb Trastuzumab (MSQC22) is designed to be a standard for the analysis of Trastuzumab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILuMab Trastuzumab (MSQC23).


SigmaMAb Trastuzumab comprises 500 mg of lyophilized antibody from the phosphate-buffered saline solution.

Sequence

SigmaMab Trastuzumab Heavy Chain:
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Trastuzumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Other Notes

SigmaMAb Trastuzumab is for R&D use only. Not for drugs, households, or other uses.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 3

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

SDS

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service