MSST0009

Sigma-Aldrich

SILuProt MAPK1 Mitogen Activated Protein Kinase 1 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N -labeled

Synonym(s):
Extracellular signal-regulated kinase 2 (Erk2), Mitogen-activated protein kinase 1 (MAPK1)
NACRES:
NA.12

recombinant

expressed in HEK 293 cells

Quality Level

assay

≥95% (SDS-PAGE)

form

liquid

potency

≥98% Heavy amino acids incorporation efficiency by MS

conjugate

His tagged

suitability

suitable for mass spectrometry (standard)

UniProt accession no.

storage temp.

−20°C

Related Categories

General description

SILuProt MAPK1 is a recombinant, stable isotope-labeled human MAPK1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of MAPK1 in mass-spectrometry. SILuProt MAPK1 is a monomer of 380 amino acids (including polyhistidine and flag tags), with an apparent molecular weight of 44 kDa.

Biochem/physiol Actions

MAPK1 is a cytoplasmic protein that following activation is capable of translocating to the nucleus where it phosphorylates and regulates nuclear proteins (e.g., Elk-1, c-Myc, c-Jun, c-Fos, and C/EBP β). It is a protein serine/threonine kinase that is a member of the extracellular signal-regulated kinases (ERKs) which are activated in response to numerous growth factors and cytokines. Aberrations in the RAS-MAPK complex (of which MAPK1 is a downstream effector) are implicated in several human cancers, and this renders the pathway an attractive therapeutic target.

Sequence

MDYKDDDDKGHHHHHHHHGGQAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Physical form

Supplied as a 0.1 mg/mL solution of 20mM sodium phosphate, pH 8.0, 1M NaCl.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Pictograms

Exclamation mark

Signal Word

Warning

Hazard Statements

Precautionary Statements

RIDADR

NONH for all modes of transport

WGK Germany

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.