MilliporeSigma
All Photos(1)

Documents

MSST0038

Sigma-Aldrich

SILuLite IGFBP7 Insulin-like growth factor-binding protein 7 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sign Into View Organizational & Contract Pricing

Synonym(s):
IBP-7, IGF-binding protein 7, IGF-bindingprotein7, IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF)
NACRES:
NA.12

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98 Heavy amino acids incorporation efficiency by MS

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (internal calibrator)

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... IGFBP7(3490)

Related Categories

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MSST0037MSST0058MSST0014
biological source

human

biological source

human

biological source

-

biological source

human

assay

≥98% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

assay

≥95% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

recombinant

expressed in HEK 293 cells

recombinant

expressed in HEK 293 cells

recombinant

expressed in HEK 293 cells

recombinant

expressed in HEK 293 cells

UniProt accession no.

Q16270

UniProt accession no.

Q16270

UniProt accession no.

P10145

UniProt accession no.

P02760

suitability

suitable for mass spectrometry (internal calibrator)

suitability

suitable for mass spectrometry (standard)

suitability

suitable for mass spectrometry (internal calibrator)

suitability

suitable for mass spectrometry (internal calibrator)

General description

IGFBP7 (insulin-like growth factor-binding protein 7) belongs to the IGFBP superfamily and is widely expressed in tissues. It contains 11 cysteines, a heparin binding site, a kazal-type trypsin inhibitor domain and a carboxyl-terminal immunoglobulin-like type C repeat. IGFBP7 binds weakly to IGFs (insulin like growth factors) and strongly to insulin. It mainly participates in IGF-independent pathways. The IGFBP7 gene is mapped to human chromosome 4q12.
SILu Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Immunogen

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Biochem/physiol Actions

IGFBP7 (insulin-like growth factor-binding protein 7) acts as a tumor suppressor as well as an oncogene by controlling cell proliferation, cell attachment, apoptosis and angiogenesis. It is also involved in TGFβ (transforming growth factor beta) signal pathway. IGFBP7 interferes with the insulin pathway and is associated with the development of diabetes as well as cardiovascular diseases.
SILuLite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Methylation status of insulin-like growth factor-binding protein 7 concurs with the malignance of oral tongue cancer.
Chen L H, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 20-20 (2015)
Yi Liu et al.
Scientific reports, 5, 10227-10227 (2015-05-20)
Metabolic syndrome (MetS), one of the major public health concerns, is regarded as the "common soil" of incidence of common chronic diseases and may increase the risk of type 2 diabetes. The predominant underlying mechanism of MetS is insulin resistance
Overexpressed Skp2 within 5p amplification detected by array?based comparative genomic hybridization is associated with poor prognosis of glioblastomas
Saigusa K, et al.
Cancer Science, 96(10), 676-683 (2005)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service