MilliporeSigma
All Photos(1)

Documents

MSST0063

Sigma-Aldrich

SILuProt IGF-1, Insulin Growth Factor -1 human

recombinant, expressed in E. coli, SIL MS Protein Standard, 15N-labeled

Sign Into View Organizational & Contract Pricing

Synonym(s):
IGF-A, Human, Insulin Growth Factor-I, Human, Insulin-Like Growth Factor-I, Human, Insulin-like growth factor I, Myotrophin, SM-C, Somatomedin 1, Sulfation Factor C, rhIGF-I
NACRES:
NA.12

recombinant

expressed in E. coli

Quality Level

assay

≥95% (SDS-PAGE)

form

lyophilized

potency

≥97% (Heavy amino acids incorporation efficiency by MS)

suitability

suitable for mass spectrometry (standard)

UniProt accession no.

shipped in

ambient

storage temp.

−20°C

Related Categories

General description

SILuProt IGF-1 is a recombinant, stable 15N isotope-labeled human IGF-1. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of IGF-1 in mass-spectrometry. SILuProt IGF-1 is a protein of 70 amino acids, with a calculated molecular mass of 7.74 kDa.

Biochem/physiol Actions

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 2


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service