SAB1401873

Anti-INHBE antibody produced in rabbit

Name: Anti-INHBE antibody produced in rabbit
Brand: SIGMA
Price: 580 USD
Availability: InStock

purified immunoglobulin, buffered aqueous solution

Synonym(s):

MGC4638

Slide 1 of 4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG

$580.00

Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Key Documents

View All Documentation

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

mouse, human

technique(s)

immunoprecipitation (IP): suitable
western blot: 1 μg/mL

NCBI accession no.

NM_031479

UniProt accession no.

P58166

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... INHBE(83729)

Related Categories

Antibodies - Primary, Secondary & Recombinant Monoclonal

Antibodies by Application

Primary Antibodies

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	SAB1401874	SAB3500193	SAB1407476
Sigma-Aldrich SAB1401873 Anti-INHBE antibody produced in rabbit	Sigma-Aldrich SAB1401874 Monoclonal Anti-INHBE antibody produced in mouse	Sigma-Aldrich SAB3500193 Anti-IRAK-M antibody produced in rabbit	Sigma-Aldrich SAB1407476 Anti-THEG antibody produced in mouse
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source mouse	biological source rabbit	biological source mouse
antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form purified immunoglobulin
species reactivity mouse, human	species reactivity human	species reactivity rat, mouse, human	species reactivity human
technique(s) immunoprecipitation (IP): suitable, western blot: 1 μg/mL	technique(s) capture ELISA: suitable	technique(s) immunofluorescence: suitable, immunohistochemistry: suitable, indirect ELISA: suitable, western blot: suitable	technique(s) western blot: 1 μg/mL

General description

Inhibin subunit beta E (INHBE) is a dimeric protein, which is majorly expressed in human liver. The gene is located on human chromosome 12q13.3.

Immunogen

INHBE (NP_113667.1, 1 a.a. ~ 350 a.a) full-length human protein.

Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Biochem/physiol Actions

Inhibin subunit beta E (INHBE) may be associated with carcinogenesis. Differential expression of INHBE in human endometrial tissue plays an important role in endometrial maturation and blastocyst implantation. The protein is a hepatokine linked to hepatic gene expression. It is associated with insulin resistance and body mass index in humans. The protein expression in liver is stimulated by insulin. It is involved in glucose metabolism.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

An insight into the phylogenetic history of HOX linked gene families in vertebrates

Abbasi AA, et al.

BMC Evolutionary Biology, 7(1), 239-239 (2007)

Inhibin betaE (INHBE) is a possible insulin resistance-associated hepatokine identified by comprehensive gene expression analysis in human liver biopsy samples

Sugiyama M, et al.

PLoS ONE, 13(3), e0194798-e0194798 (2018)

cDNA cloning and expression of human activin betaE subunit

Hashimoto O, et al.

Molecular and Cellular Endocrinology, 194(1-2), 117-122 (2002)

Evidence of inhibin/activin subunit betaC and betaE synthesis in normal human endometrial tissue

Mylonas L and Br

Reproductive Biology and Endocrinology, 8(1), 143-143 (2010)

Inhibin/activin-betaE subunit in normal and malignant human cervical tissue and cervical cancer cell lines.

Florian Bergauer et al.

Journal of molecular histology, 40(5-6), 353-359 (2009-12-25)

Inhibins are dimeric glycoproteins, composed of an alpha-subunit and one of two possible beta-subunits (betaA or betaB), with substantial roles in human reproduction and in endocrine-responsive tumours. Recently a novel beta subunit named betaE was described, although it is still

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service