MilliporeSigma
All Photos(1)

SAB1401983

Sigma-Aldrich

Anti-COX6B2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonym(s):
MGC119094, COXVIB2
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... COX6B2(125965)

Immunogen

COX6B2 (NP_653214.2, 1 a.a. ~ 88 a.a) full-length human protein.

Sequence
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Chun-Chun Cheng et al.
eLife, 9 (2020-09-30)
Cancer testis antigens (CTAs) are proteins whose expression is normally restricted to the testis but anomalously activated in human cancer. In sperm, a number of CTAs support energy generation, however, whether they contribute to tumor metabolism is not understood. We

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service