SAB1402174

Monoclonal Anti-DLX6 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC125282, MGC125283, MGC125284, MGC125285
• NACRES: NA.41
• UNSPSC Code: 12352203

Properties

• Product Name: Monoclonal Anti-DLX6 antibody produced in mouse, clone 2D7, purified immunoglobulin, buffered aqueous solution
• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2D7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.01 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: XM_376652
• UniProt accession no.: P56179
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... DLX6(1750)

Description

General description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. (provided by RefSeq)

Immunogen

DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable