MilliporeSigma
All Photos(3)

SAB1402514

Sigma-Aldrich

Monoclonal Anti-RAPGEF3 antibody produced in mouse

clone 2E5, purified immunoglobulin, buffered aqueous solution

Synonym(s):
EPAC, MGC21410, CAMP-GEFI, HSU79275, EPAC1, bcm910
NACRES:
NA.41

Quality Level

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2E5, monoclonal

form

buffered aqueous solution

mol wt

antigen ~38.1 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... RAPGEF3(10411)

Immunogen

RAPGEF3 (AAH17728, 772 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

13 - Non Combustible Solids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Andrea Heldsinger et al.
Endocrinology, 155(10), 3956-3969 (2014-07-26)
The anorexigenic adipocyte-derived hormone leptin and the orexigenic hormone ghrelin act in opposition to regulate feeding behavior via the vagal afferent pathways. The mechanisms by which ghrelin exerts its inhibitory effects on leptin are unknown. We hypothesized that ghrelin activates

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service