MilliporeSigma
All Photos(1)

Documents

SAB1402835

Sigma-Aldrich

Monoclonal Anti-LDHC antibody produced in mouse

clone 2C8, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
CT32, LDH3, LDHX, MGC111073
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C8, monoclonal

form

buffered aqueous solution

mol wt

antigen ~36.01 kDa

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LDHC(3948)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB5700695SAB5700839SAB2108638
vibrant-m

SAB2108638

Anti-LDHA

clone

2C8, monoclonal

clone

polyclonal

clone

polyclonal

clone

polyclonal

Gene Information

human ... LDHC(3948)

Gene Information

human ... LDHA(3939)

Gene Information

human ... LDHB(3945)

Gene Information

human ... LDHA(3939)

antibody form

purified immunoglobulin

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

species reactivity

human

species reactivity

human, mouse, rat

species reactivity

rat, mouse, human

species reactivity

human

conjugate

unconjugated

conjugate

-

conjugate

-

conjugate

unconjugated

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5′ untranslated region. (provided by RefSeq)

Immunogen

LDHC (NP_002292.1, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIG

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Maitham A Khajah et al.
Frontiers in pharmacology, 12, 747001-747001 (2021-11-09)
Background: Lactate dehydrogenase (LDH) plays an important role in cancer pathogenesis and enhanced expression/activity of this enzyme has been correlated with poor prognosis. In this study we determined the expression profile of LDH-A and B in normal as well as

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service