MilliporeSigma
All Photos(3)

Documents

SAB1402964

Sigma-Aldrich

Monoclonal Anti-ZNF23 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
KOX16, MGC57283, ZNF359, ZNF612, Zfp612
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D3, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZNF23(7571)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
HPA023534SAB1404540SAB1404554
antibody form

purified immunoglobulin

antibody form

affinity isolated antibody

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

human

biological source

mouse

biological source

rabbit

biological source

mouse

biological source

mouse

clone

2D3, monoclonal

clone

polyclonal

clone

2G5, monoclonal

clone

3D3, monoclonal

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

The gene ZNF23 (zinc finger protein 23) is mapped to human chromosome 16q22, a region associated with frequent alterations in acute myeloid leukemia. It belongs to the family of KRAB–ZFPs (Krupple-associated box-containing zinc-finger proteins), a large family of transcription factors. These proteins contain a KRAB domain at the N-terminal. The C-terminal consists of 16 tandem C2H2 class zinc fingers. The protein is ubiquitously expressed and the levels are greatly decreased or lost in cases of human cancer. The gene spans a length of 3271 nucleotides that encodes a protein of 643 amino acids.

Immunogen

ZNF23 (NP_666016.1, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP

Biochem/physiol Actions

The gene ZNF23 (zinc finger protein 23) encodes a nuclear protein that is involved in the inhibition of cell cycle progression. Ectopic expression of this protein is associated with increased p27kip-1 expression, growth inhibition and cell cycle arrest in G1 phase. The gene functions as a tumor suppressor, as its down regulation has been associated with carcinogenesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Characterization of ZNF23, a KRAB-containing protein that is downregulated in human cancers and inhibits cell cycle progression.
Huang C
Experimental Cell Research, 313, 254-263 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service