SAB1403417

Sigma-Aldrich

Monoclonal Anti-TRIM47, (C-terminal) antibody produced in mouse

clone 3C8, purified immunoglobulin, buffered aqueous solution

Synonym(s):
GOA, RNF100
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3C8, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

human

application(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... TRIM47(91107)

Immunogen

TRIM47 (NP_258411, 539 a.a. ~ 638 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR

Physical form

Solution in phosphate buffered saline, pH 7.4

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.