All Photos(3)

SAB1403527

Sigma-Aldrich

Monoclonal Anti-PARP1, (N-terminal) antibody produced in mouse

clone 2C7, purified immunoglobulin, buffered aqueous solution

Synonym(s):
ADPRT1, PPOL, PARP-1, ADPRT, pADPRT-1, PARP
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C7, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37 kDa

species reactivity

human

application(s)

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... PARP1(142)

General description

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein which possesses three functional domains. It belongs to the PARP family and the gene encoding it is localized on human chromosome 1q42.

Immunogen

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Biochem/physiol Actions

Poly (ADP-ribose) polymerase 1 (PARP1) has a role in DNA repair and acts as a facilitator of homologous recombination. It controls transcription by modulating chromatin structure and altering DNA methylation patterns. The protein functions as a co-regulator of transcription factors and associates with chromatin insulators. PARP1 also has an important role in protection of the cardiovascular system.

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

13 - Non Combustible Solids

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

PARP inhibition: PARP1 and beyond
Michele Rouleau
Nature Reviews. Cancer (2010)
PARP-1 protein expression in glioblastoma multiforme
A, Galia
European Journal of Histochemistry (2012)
Trapping of PARP1 and PARP2 by Clinical PARP Inhibitors.
Murai J
Cancer Research (2012)
Shaohua Chen et al.
Cancer letters, 348(1-2), 20-28 (2014-02-19)
In this study, we explored the antitumor activities of the PARP inhibitor AZD2281 (Olaparib) and the pan-Bcl-2 inhibitor GX15-070 (Obatoclax) in six pancreatic cancer cell lines. While both agents were able to cause growth arrest and limited apoptosis, the combination...
Makiko Yamashita et al.
Human molecular genetics, 23(16), 4345-4356 (2014-04-05)
TAR DNA-binding protein of 43 kDa (TDP-43) is the major component protein of inclusions found in brains of patients with amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD-TDP). However, the molecular mechanisms by which TDP-43 causes neuronal dysfunction and...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service