SAB1403571

Monoclonal Anti-RHOH antibody produced in mouse

clone 4H5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): ARHH, TTF
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 4H5, monoclonal
• Application: indirect ELISA
• Species reactivity: human
• Technique(s): indirect ELISA: suitable
• Uniprot accession no.: Q15669

Properties

• Product Name: Monoclonal Anti-RHOH antibody produced in mouse, clone 4H5, purified immunoglobulin, buffered aqueous solution
• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4H5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~47.12 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2bκ
• NCBI accession no.: BC014261
• UniProt accession no.: Q15669
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... RHOH(399)

Description

General description

The protein encoded by this gene is a member of the Ras superfamily of small GTPases. Expression of a chimeric transcript of LAZ3 and this gene has been reported as a result of the translocation t(3;4) in non-Hodgkin′s lymphomas. This gene encodes a small G-like protein, and unlike most other small G proteins which are expressed ubiquitously, this gene is transcribed only in hemopoietic cells. (provided by RefSeq)

Immunogen

RHOH (AAH14261.1, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVVTQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable