SAB1404452

Monoclonal Anti-TCF3, (C-terminal) antibody produced in mouse

clone 5G2, ascites fluid

• Synonym(s): E2A, ITF1, MGC129647, MGC129648, bHLHb21
• NACRES: NA.41
• UNSPSC Code: 12352203

Properties

• Product Name: Monoclonal Anti-TCF3, (C-terminal) antibody produced in mouse, clone 5G2, ascites fluid
• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 5G2, monoclonal
• mol wt: antigen ~38.21 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgG2bκ
• NCBI accession no.: NM_003200
• UniProt accession no.: P15923
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Quality Level: 100
• Gene Information: human ... TCF3(6929)

Description

General description

The TCF3 gene, also called E2A, encodes 2 basic helix-loop-helix (bHLH) transcription factors, E12 and E47, through alternative splicing. E12 and E47 are involved in regulation of immunoglobulin gene expression (Bain et al., 1994 [PubMed 8001125]).[supplied by OMIM

Immunogen

TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM

Physical form

Clear solution

Safety Information

• Storage Class: 11 - Combustible Solids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable