All Photos(3)

SAB1405091

Sigma-Aldrich

Monoclonal Anti-FZR1, (N-terminal) antibody produced in mouse

clone 3E12, purified immunoglobulin, buffered aqueous solution

Synonym(s):
CDC20C, KIAA1242, FZR2, CDH1, FZR, HCDH1, HCDH
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3E12, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.22 kDa

species reactivity

human

application(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... FZR1(51343)

Immunogen

FZR1 (NP_057347.2, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLG

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

13 - Non Combustible Solids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

Kaishun Hu et al.
Oncotarget, 5(10), 3088-3100 (2013-03-21)
Osteosarcoma is the most common primary malignant bone tumor in childhood and adolescence and has a propensity for local invasion and early lung metastasis. However, the current therapies often result in chemoresistance, and a therapeutic target is not available in...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service