SAB1405157

Monoclonal Anti-ASF1B antibody produced in mouse

clone 1B12, purified immunoglobulin, buffered aqueous solution

• Synonym(s): CIA-II, FLJ10604
• NACRES: NA.43
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 1B12, monoclonal
• Application: ELISA (c), ELISA (i), IF, WB
• Citations: -

Properties

• biological source: mouse
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1B12, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~48.33 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable, immunofluorescence: suitable, indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC036521
• UniProt accession no.: Q9NVP2
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ASF1B(55723)

Description

General description

This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. (provided by RefSeq)

Immunogen

ASF1B (AAH36521, 1 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFGQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable