SAB1406607

Sigma-Aldrich

Anti-ZNF23 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):
KOX16, MGC57283, ZNF359, ZNF612, Zfp612
NACRES:
NA.41
Pricing and availability is not currently available.

Quality Level

biological source

mouse

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~73.1 kDa

species reactivity

human

application(s)

western blot: 1 μg/mL

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... ZNF23(7571)

General description

The gene ZNF23 (zinc finger protein 23) is mapped to human chromosome 16q22, a region associated with frequent alterations in acute myeloid leukemia. It belongs to the family of KRAB–ZFPs (Krupple-associated box-containing zinc-finger proteins), a large family of transcription factors. These proteins contain a KRAB domain at the N-terminal. The C-terminal consists of 16 tandem C2H2 class zinc fingers. The protein is ubiquitously expressed and the levels are greatly decreased or lost in cases of human cancer. The gene spans a length of 3271 nucleotides that encodes a protein of 643 amino acids.

Immunogen

ZNF23 (NP_666016.1, 1 a.a. ~ 643 a.a) full-length human protein.

Sequence
MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYITHQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS

Biochem/physiol Actions

The gene ZNF23 (zinc finger protein 23) encodes a nuclear protein that is involved in the inhibition of cell cycle progression. Ectopic expression of this protein is associated with increased p27kip-1 expression, growth inhibition and cell cycle arrest in G1 phase. The gene functions as a tumor suppressor, as its down regulation has been associated with carcinogenesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

RIDADR

NONH for all modes of transport

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Characterization of ZNF23, a KRAB-containing protein that is downregulated in human cancers and inhibits cell cycle progression.
Huang C
Experimental Cell Research, 313, 254-263 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon
Instagram Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.