SAB1408989

Monoclonal Anti-ALDH2 antibody produced in mouse

clone 4F10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): ALDH-E2, ALDHI, ALDM, MGC1806
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4F10, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 37.84 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: BC002967
• UniProt accession no.: P05091
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ALDH2(217)

Description

General description

This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. (provided by RefSeq)

Immunogen

ALDH2 (AAH02967, 408 a.a. ~ 517 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable