SAB1409599

Sigma-Aldrich

Monoclonal Anti-RBL2 antibody produced in mouse

clone 1F11, ascites fluid, solution

Synonym(s):
FLJ26459, P130, Rb2
NACRES:
NA.41

Quality Level

biological source

mouse

antibody form

ascites fluid

antibody product type

primary antibodies

clone

1F11, monoclonal

form

solution

mol wt

antigen 32.56 kDa

species reactivity

human

application(s)

indirect ELISA: suitable

isotype

IgMκ

conjugate

unconjugated

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... RBL2(5934)

Immunogen

RBL2 (-, 936 a.a. ~ 998 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKRRNSGSSDSRSHQNSPTELNKDRTSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDM

Physical form

Clear solution

storage_class_code

12 - Non Combustible Liquids

WGK Germany

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Certificate of Origin

C L Pang et al.
Oncogene, 33(31), 4039-4049 (2013-10-22)
High-risk human papillomaviruses are causative agents of cervical cancer. Viral protein E7 is required to establish and maintain the pro-oncogenic phenotype in infected cells, but the molecular mechanisms by which E7 promotes carcinogenesis are only partially understood. Our transcriptome analyses...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service