SAB1410302

Anti-DLX6 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC125282, MGC125283, MGC125284, MGC125285
• NACRES: NA.41
• UNSPSC Code: 12352203

Properties

• Product Name: Anti-DLX6 antibody produced in rabbit, purified immunoglobulin, buffered aqueous solution
• biological source: rabbit
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 19.7 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: BC069363.1
• UniProt accession no.: P56179
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DLX6(1750)

Description

General description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. (provided by RefSeq)

Immunogen

DLX6 (AAH69363.1, 1 a.a. ~ 175 a.a) full-length human protein.

Sequence
MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable