SAB1412056
ANTI-NKX3-1 antibody produced in mouse
clone 3C1, purified immunoglobulin, buffered aqueous solution
Recommended Products
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3C1, monoclonal
form
buffered aqueous solution
mol wt
antigen 37.84 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
Gene Information
human ... NKX3-1(4824)
Compare Similar Items
View Full Comparison1 of 4
This Item | HPA036774 | SAB3500757 | SAB1412289 |
|---|---|---|---|
| biological source mouse | biological source rabbit | biological source rabbit | biological source mouse |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form purified immunoglobulin | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form purified immunoglobulin |
| clone 3C1, monoclonal | clone polyclonal | clone - | clone 3A8, monoclonal |
| form buffered aqueous solution | form buffered aqueous glycerol solution | form - | form buffered aqueous solution |
| mol wt antigen 37.84 kDa | mol wt - | mol wt 41 kDa | mol wt antigen 34.65 kDa |
General description
Immunogen
Sequence
GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
Physical form
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.
Difficulty Finding Your Product Or Lot/Batch Number?
How to Find the Product Number
Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (Example: T1503).
Example:
Additional examples:
705578-5MG-PW
PL860-CGA/SHF-1EA
MMYOMAG-74K-13
1000309185
enter as 1.000309185)
Having trouble? Feel free to contact Technical Service for assistance.
How to Find a Lot/Batch Number for COA
Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.
Aldrich Products
For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').
For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').
For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.
Not Finding What You Are Looking For?
In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service