MilliporeSigma
All Photos(2)

SAB1412056

Sigma-Aldrich

ANTI-NKX3-1 antibody produced in mouse

clone 3C1, purified immunoglobulin, buffered aqueous solution

Synonym(s):
BAPX2, NKX3-1, NKX3, NKX3A, NKX3.1
NACRES:
NA.41

Quality Level

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3C1, monoclonal

form

buffered aqueous solution

mol wt

antigen 37.84 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... NKX3-1(4824)

General description

The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM

Immunogen

NKX3-1 (NP_006158, 100 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS

Physical form

Solution in phosphate buffered saline, pH 7.4

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Jue Jiang et al.
Cancer cell, 37(2), 200-215 (2020-02-13)
Deregulation of MYC plays an essential role in T cell acute lymphoblastic leukemia (T-ALL), yet the mechanisms underlying its deregulation remain elusive. Herein, we identify a molecular mechanism responsible for reciprocal activation between Aurora B kinase (AURKB) and MYC. AURKB directly
Helizabet S Abdalla Ribeiro et al.
Histology and histopathology, 29(9), 1129-1133 (2013-08-24)
Since endometriosis is a proliferative disease we evaluated the presence of anti-apoptotic factor (Bcl-2) and pro-apoptotic factor (Bax) in deep pelvic endometriosis. A Cross-sectional observational study was performed at Santa Casa de Misericórdia de São Paulo, São Paulo, Brazil. Forty
Wei Jin et al.
Pharmacology, biochemistry, and behavior, 124, 145-152 (2014-06-10)
Lipoxin A4 (LXA4) is known for its powerful anti-inflammatory function. Current studies in vitro suggest that LXA4 possesses novel antioxidant effect. The aim of this study is to examine whether Lipoxin A4 methyl ester (LXA4 ME) has neuroprotective effects against
Xing Liu et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(26), 8741-8748 (2014-06-27)
NMDA receptor-dependent long-term depression (NMDAR-LTD) is a form of synaptic plasticity leading to long-lasting decreases in synaptic strength. NMDAR-LTD is essential for spatial and working memory, but its role in hippocampus-dependent fear memory has yet to be determined. Induction of
Jianyong Zhong et al.
Laboratory investigation; a journal of technical methods and pathology, 94(6), 633-644 (2014-04-02)
Plasminogen activator inhibitor-1 (PAI-1) promotes or abates fibrotic processes occurring in different organs. Binding of PAI-1 to vitronectin, an extracellular matrix component, may inhibit vitronectin-integrin complex-mediated cellular responses in pathophysiological conditions. To investigate the importance of plasmin suppression vs vitronectin-binding

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service